| Desktop | 0/100 | ✘ |
| Mobile | 44/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 118 KB | ✔ |
| Compression | 15 KB (-87.6%) | ✔ |
| Text/Html Ratio | 1347 / 127480 (bytes) = 1.06% | ✘ |
| Load Time | 0.84 second | ✔ |
| Mobile Ready | 97/100 | ✔ |
| In-Page Links | 20 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | No | ✘ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 33 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | No | ✘ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| pressure | 6 | ✔ | ✔ | ✔ |
| service | 5 | ✘ | ✔ | ✔ |
| washing | 5 | ✔ | ✔ | ✔ |
| more | 3 | ✔ | ✔ | ✔ |
| payments | 3 | ✘ | ✘ | ✘ |
| contact | 3 | ✘ | ✘ | ✘ |
| reviews | 3 | ✘ | ✘ | ✘ |
| gallery | 3 | ✘ | ✘ | ✘ |
| pricing | 3 | ✘ | ✘ | ✘ |
| services | 3 | ✘ | ✔ | ✔ |
| home | 3 | ✘ | ✘ | ✘ |
| driveways | 2 | ✔ | ✔ | ✔ |
| everyneed | 1 | ✘ | ✘ | ✘ |
| have | 1 | ✘ | ✘ | ✘ |
| they | 1 | ✘ | ✘ | ✘ |
|
With 0.84 seconds in page load, 118 KB of page size and all other reports below, the pressurewashingserviceinlakemary.com has a SEO score of 57 out of 100 |
| Title | Driveways & More Pressure Washing LLC | Driveways & More Pressure Washing LLC |
| Description | Driveways & More Pressure Washing LLC is a pressure washing service that is licensed, insured and services Lake Mary, FL and surrounding areas. Whether you are in need of a fence soft washed, driveway high pressure washed or vinyl siding maintained, we can do it all. Call us today, we are only a phone call away! |
| Keyword |
| Age | 0 Years, 7 Days |
| Created | 10th-May-2020 |
| Updated | 10th-May-2020 |
| Expiry | 10th-May-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
Domain Name: pressurewashingserviceinlakemary.com Registry Domain ID: 2524197589_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-05-10T01:08:04Z Creation Date: 2020-05-10T01:08:03Z Registrar Registration Expiration Date: 2021-05-10T01:08:03Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 14455 N. Hayden Road Registrant City: Scottsdale Registrant State/Province: Arizona Registrant Postal Code: 85260 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: pressurewashingserviceinlakemary.com@domainsbyproxy.com Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 14455 N. Hayden Road Admin City: Scottsdale Admin State/Province: Arizona Admin Postal Code: 85260 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: pressurewashingserviceinlakemary.com@domainsbyproxy.com Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 14455 N. Hayden Road Tech City: Scottsdale Tech State/Province: Arizona Tech Postal Code: 85260 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: pressurewashingserviceinlakemary.com@domainsbyproxy.com Name Server: NS75.DOMAINCONTROL.COM Name Server: NS76.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-05-17T06:00:00Z |
| Server IP | 184.168.131.241 |
| Server Location | United States |
| Service Provider | GoDaddy.com, LLC |
| Domains (TLD) | Status |
|---|---|
| pressurewashingserviceinlakemary.net | Available |
| pressurewashingserviceinlakemary.org | Available |
| pressurewashingserviceinlakemary.biz | Already Registered |
| pressurewashingserviceinlakemary.io | Already Registered |
| pressurewashingserviceinlakemary.info | Available |
| Domains (TLD) | Status |
|---|---|
| presurewashingserviceinlakemary.com | Available |
| oressurewashingserviceinlakemary.com | Available |
| lressurewashingserviceinlakemary.com | Available |
| peessurewashingserviceinlakemary.com | Available |
| pdessurewashingserviceinlakemary.com | Available |
| Tdsgang.com |
| Rightdecisioncoaching.com |
| Cbdvapevietnam.com |
| Recortes.net |
| Facemasksshiptoday.com |
| Essentiagym.com |
| Scalppsoriasishelper.com |
| Fronoco.com |
| Remedioparacalvice.guru |
| Healthandfitnessmatrix.com |